Protein Info for Psyr_0443 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Triphosphoribosyl-dephospho-CoA synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 TIGR03132: triphosphoribosyl-dephospho-CoA synthase MdcB" amino acids 14 to 281 (268 residues), 355.4 bits, see alignment E=1.1e-110 PF01874: CitG" amino acids 18 to 278 (261 residues), 244 bits, see alignment E=1.2e-76

Best Hits

Swiss-Prot: 100% identical to MDCB_PSEU2: Probable 2-(5''-triphosphoribosyl)-3'-dephosphocoenzyme-A synthase (mdcB) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K13930, triphosphoribosyl-dephospho-CoA synthase [EC: 2.7.8.25] (inferred from 100% identity to psb:Psyr_0443)

Predicted SEED Role

"Triphosphoribosyl-dephospho-CoA synthetase (EC 2.7.8.25)" in subsystem Malonate decarboxylase (EC 2.7.8.25)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZA9 at UniProt or InterPro

Protein Sequence (291 amino acids)

>Psyr_0443 Triphosphoribosyl-dephospho-CoA synthase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MSALQWSPHPASLAERLADLAVDALIDEADLSPKPALVDRRGSGAHTDLHLGLMHSSALS
LWPTFKWMADAATQFGVVGQPLREALGRLGREGEATMLRTTSGVNTHRGAIWALGLLVTA
AALDAQECAPEAICARAGALARIKDRQVLTQNSHGDQVVRRYGVMGAREQAQQGFPAVRL
FALPQLQRSRAAGSGEQNARLDALLAIMTTLDDTCVLHRAGIEGLNAMQQGAQRVLYAGG
SVSLAGRRALNALDQHLLALNASPGGAADLLAACLFIDGLEPALGPVSRSA