Protein Info for Psyr_0375 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: prolyl aminopeptidase, Serine peptidase, MEROPS family S33

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 TIGR01249: prolyl aminopeptidase" amino acids 9 to 309 (301 residues), 428.6 bits, see alignment E=6.3e-133 PF00561: Abhydrolase_1" amino acids 36 to 295 (260 residues), 129.1 bits, see alignment E=3.5e-41 PF12697: Abhydrolase_6" amino acids 37 to 296 (260 residues), 56.4 bits, see alignment E=1.1e-18 PF12146: Hydrolase_4" amino acids 37 to 294 (258 residues), 56.4 bits, see alignment E=4.3e-19

Best Hits

Swiss-Prot: 55% identical to PIP_XYLFA: Proline iminopeptidase (pip) from Xylella fastidiosa (strain 9a5c)

KEGG orthology group: K01259, proline iminopeptidase [EC: 3.4.11.5] (inferred from 100% identity to psb:Psyr_0375)

Predicted SEED Role

"Proline iminopeptidase (EC 3.4.11.5)" in subsystem Proline, 4-hydroxyproline uptake and utilization (EC 3.4.11.5)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.11.5

Use Curated BLAST to search for 3.4.11.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZH7 at UniProt or InterPro

Protein Sequence (323 amino acids)

>Psyr_0375 prolyl aminopeptidase, Serine peptidase, MEROPS family S33 (Pseudomonas syringae pv. syringae B728a ΔmexB)
MQTLYPQIKPYARHDLAVEQPHVLYVDESGSPEGLPVVFIHGGPGSGCDAHSRCYFDPNL
YRIVTFDQRGCGRSTPHASLENNTTWKLVEDLEAIREHLGIDKWVLFGGSWGSTLALAYA
QTHPDRVHAMILRGVFLARQQEIDWFYQAGASRLFPDYWQDYVAPIPLDERDNILAAFHK
RLTGPDQIAQMHAAKAWSTWEGRCATLRPNPQVVDRFAEPHRALSIARIECHYFMNNAFL
EDNQLIRDMPKIAHLPAIIVHGRYDVICPLDNAWELHQNWPGSELQVIREAGHSAAEPGI
ADALVRAAAEVARNLLDLPPEEA