Protein Info for Psyr_0185 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: tyrosine recombinase XerC subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 PF02899: Phage_int_SAM_1" amino acids 5 to 88 (84 residues), 83.3 bits, see alignment E=1.3e-27 TIGR02224: tyrosine recombinase XerC" amino acids 7 to 293 (287 residues), 363.6 bits, see alignment E=4e-113 PF00589: Phage_integrase" amino acids 111 to 279 (169 residues), 155.3 bits, see alignment E=1.4e-49

Best Hits

Swiss-Prot: 100% identical to XERC_PSEU2: Tyrosine recombinase XerC (xerC) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K03733, integrase/recombinase XerC (inferred from 100% identity to psb:Psyr_0185)

Predicted SEED Role

"Tyrosine recombinase XerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q500B4 at UniProt or InterPro

Protein Sequence (299 amino acids)

>Psyr_0185 tyrosine recombinase XerC subunit (Pseudomonas syringae pv. syringae B728a ΔmexB)
MDQHLDAYCMHLRSERQVSPHTLEAYRRDLGKVLAYCQKAQVSSWSDLDIQHLRSFTARQ
HQQGQSSRSLARMLSAVRGFYKYLNREGICQHDPANGLSPPKGERRLPKTLDTDRAAQLL
DGGVEDDFLAHRDQAILELLYSSGLRLSELTGLNLDQLDLRDGLVQVLGKGSKTRVLPVG
SKARQALEVWLPLRALTNPQDDAVFVSQQGKRLGPRAIQVRLKAAGERELGQNLHPHMLR
HSFASHLLESSQDLRAVQELLGHADIKTTQIYTHLDFQHLATVYDSAHPRAKRKGTADD