Protein Info for Psyr_0152 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: FAD-dependent pyridine nucleotide-disulfide oxidoreductase:BFD-like [2Fe-2S]-binding region

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 PF07992: Pyr_redox_2" amino acids 16 to 330 (315 residues), 104.8 bits, see alignment E=1.5e-33 PF13450: NAD_binding_8" amino acids 19 to 73 (55 residues), 25.7 bits, see alignment 2.8e-09 PF04324: Fer2_BFD" amino acids 386 to 438 (53 residues), 27.8 bits, see alignment 6.4e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0152)

Predicted SEED Role

"Opine oxidase subunit A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q500E7 at UniProt or InterPro

Protein Sequence (469 amino acids)

>Psyr_0152 FAD-dependent pyridine nucleotide-disulfide oxidoreductase:BFD-like [2Fe-2S]-binding region (Pseudomonas syringae pv. syringae B728a ΔmexB)
MATSSRLDVRNPGSPRVVIIGAGPAGTRCAETLLAAGIKPILIDENRRDGGQIYRRQPEG
FKRDYSALYGTEAAKARDLHESFDRLRPQIDYRPDTLAWNLTHGELCCASQGVHTVIEYD
ALILCAGATDRLMPIKGWQLAGTYSLGGSQIALKSQSVSIGSRVVFMGSGPLLYLVASQY
VKAGADVAAVLDTSPFGKRVSAMPKLLARPGLLFNGMKLLGQLYSAGVPVHLGVQPEEII
GSEQDGVTGVRVKLANGNALSVDCDALALGYHLRPETQLADLAGCQLRFDEASGQWVLAV
DEEGRTSVKGFYAAGDGAKIRGADAAEQAGRLVAMALLEDLGRPVDNSRQAEVRKSLVAM
DRFRVGLAEAFPWPAAQAAALPDEAIVCRCEMISAGELRGVVREKGACEVNRAKAFSRVG
MGRCQGRYCSQAGAEVIAAEAGVPVEQVGRQRGQAPVKPLSMLIDEVAS