Protein Info for Psyr_0001 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: chromosomal replication initiator protein DnaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 PF11638: DnaA_N" amino acids 4 to 63 (60 residues), 73.1 bits, see alignment E=3e-24 TIGR00362: chromosomal replication initiator protein DnaA" amino acids 6 to 509 (504 residues), 629.7 bits, see alignment E=1.5e-193 PF00308: Bac_DnaA" amino acids 176 to 393 (218 residues), 337.8 bits, see alignment E=8.6e-105 PF01695: IstB_IS21" amino acids 212 to 314 (103 residues), 25.3 bits, see alignment E=2.7e-09 PF00004: AAA" amino acids 213 to 323 (111 residues), 25.6 bits, see alignment E=3.7e-09 PF08299: Bac_DnaA_C" amino acids 420 to 488 (69 residues), 109.5 bits, see alignment E=1.6e-35

Best Hits

Swiss-Prot: 100% identical to DNAA_PSEU2: Chromosomal replication initiator protein DnaA (dnaA) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 100% identity to psb:Psyr_0001)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q500U7 at UniProt or InterPro

Protein Sequence (511 amino acids)

>Psyr_0001 chromosomal replication initiator protein DnaA (Pseudomonas syringae pv. syringae B728a ΔmexB)
MSVELWQQCVELLRDELPAQQFNTWIRPLQVEAEGDELRVYAPNRFVLDWVNEKYLGRLL
ELLGEHGQGMAPALSLLIGSKRSSAPRAAPNAPLAAAASQALSANSVSSVSAPAPATAAP
AAAVATPAPVQNVATHDEPSRDSFDPMAGASSQQAPARAEQRTVQVEGALKHTSYLNRTF
TFENFVEGKSNQLARAAAWQVADNPKHGYNPLFLYGGVGLGKTHLMHAVGNHLLKKNPNA
KVVYLHSERFVADMVKALQLNAINEFKRFYRSVDALLIDDIQFFARKERSQEEFFHTFNA
LLEGGQQVILTSDRYPKEIEGLEERLKSRFGWGLTVAVEPPELETRVAILMKKADQAKVD
LPHDAAFFIAQRIRSNVRELEGALKRVIAHSHFMGRDITIELIRESLKDLLALQDKLVSV
DNIQRTVAEYYKIKISDLLSKRRSRSVARPRQVAMALSKELTNHSLPEIGDVFGGRDHTT
VLHACRKINELKESDADIREDYKNLLRTLTT