Protein Info for PfGW456L13_914 in Pseudomonas fluorescens GW456-L13

Annotation: Taurine-binding periplasmic protein TauA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF13379: NMT1_2" amino acids 18 to 238 (221 residues), 45 bits, see alignment E=2.5e-15 PF04069: OpuAC" amino acids 29 to 236 (208 residues), 76.7 bits, see alignment E=4.5e-25 TIGR01729: taurine ABC transporter, periplasmic binding protein" amino acids 30 to 327 (298 residues), 437.7 bits, see alignment E=1.2e-135 PF12974: Phosphonate-bd" amino acids 50 to 222 (173 residues), 43.5 bits, see alignment E=5.6e-15 PF09084: NMT1" amino acids 67 to 244 (178 residues), 77.4 bits, see alignment E=3e-25

Best Hits

Swiss-Prot: 55% identical to TAUA_ECOLI: Taurine-binding periplasmic protein (tauA) from Escherichia coli (strain K12)

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 92% identity to pfo:Pfl01_5418)

MetaCyc: 55% identical to taurine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-64-RXN [EC: 7.6.2.7]

Predicted SEED Role

"Taurine-binding periplasmic protein TauA" in subsystem Taurine Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293PXA9 at UniProt or InterPro

Protein Sequence (329 amino acids)

>PfGW456L13_914 Taurine-binding periplasmic protein TauA (Pseudomonas fluorescens GW456-L13)
MTIKRALSRPIVTVCVSLAFSFTAQAANLTVGYQTGIDPSKVPQADGLYEKTIGQPIDWR
RFNSGPEVVTAIASGDVQIGNLGSSPLAAAASRKLPIVAFIVSAQINAAEALVVRNGSGI
EKPQDLIGKTIATPFVSTSHYSLLGALKHWGLDSSKVKVVNLQPAEIAAAWKRGDIDGAF
VWSPALGEIRKSGKTLTDAAQVGQWGAPTFEVWVARKDYAEKHPEVVARFAKVTLDAFAD
YAAHKASWTADSVPVQKIAKLTGANAADVPELLAGSAFPDAKAQQSAALLDGGTAKAIGE
TAKFLKEQGKVETVLPDYSPYVSAKFVAE