Protein Info for PfGW456L13_903 in Pseudomonas fluorescens GW456-L13

Annotation: Glycine cleavage system H protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00527: glycine cleavage system H protein
  • amino acids 4 to 125 (122 residues), 159.5 bits, E=2.1e-51
• PF01597: GCV_H
  • amino acids 8 to 124 (117 residues), 143.8 bits, E=1.2e-46

Best Hits

Swiss-Prot: 82% identical to GCSH2_PSEPK: Glycine cleavage system H protein 2 (gcvH2) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K02437, glycine cleavage system H protein (inferred from 91% identity to pfl:PFL_5961)

MetaCyc: 61% identical to glycine cleavage system H protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Glycine cleavage system H protein" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle)

MetaCyc Pathways

• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)

Sequence Analysis Tools

See A0A293QKB8 at UniProt or InterPro

Protein Sequence (127 amino acids)

>PfGW456L13_903 Glycine cleavage system H protein (Pseudomonas fluorescens GW456-L13)
MSDIPADLRFAESHEWARLEADGTVTVGISDHAQEALGDVVFVELTEVGNVFAAEDQAGV
VESVKAASDIYSPIAGEVIAVNEDLSASPELLNSDPYGAWIFKIKPSNAADLEKLLDAAG
YKAAIGE