Protein Info for PfGW456L13_582 in Pseudomonas fluorescens GW456-L13
Annotation: probable exported protein YPO0432
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to Y044_PSEPF: UPF0391 membrane protein Pfl01_0044 (Pfl01_0044) from Pseudomonas fluorescens (strain Pf0-1)
KEGG orthology group: None (inferred from 94% identity to psp:PSPPH_0249)Predicted SEED Role
"probable exported protein YPO0432"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0C2A787 at UniProt or InterPro
Protein Sequence (54 amino acids)
>PfGW456L13_582 probable exported protein YPO0432 (Pseudomonas fluorescens GW456-L13) MLSWAITFLIIAIIAAVLGFGGIAGTATGIAKILFVVFLVMFIASFFFGRRGRG