Protein Info for PfGW456L13_5032 in Pseudomonas fluorescens GW456-L13

Annotation: Rod shape-determining protein MreC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR00219: rod shape-determining protein MreC" amino acids 1 to 264 (264 residues), 217.3 bits, see alignment E=1.2e-68 PF04085: MreC" amino acids 112 to 257 (146 residues), 143.4 bits, see alignment E=2.3e-46

Best Hits

KEGG orthology group: K03570, rod shape-determining protein MreC (inferred from 85% identity to pfo:Pfl01_0839)

Predicted SEED Role

"Rod shape-determining protein MreC" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QS10 at UniProt or InterPro

Protein Sequence (362 amino acids)

>PfGW456L13_5032 Rod shape-determining protein MreC (Pseudomonas fluorescens GW456-L13)
VRLLVLVVLSVALMVVDARFSLLKPARSQMSLVLMDAYWITDLPGRLWEGVASQFGSRTE
LVAENEKLKTENLLLQGRMQKLAALTEQNVRLRELLNSSALVNEKVEVAELIGMDPNPFT
HRIIINKGERDGVVLGQPVLDARGLMGQVVELMPYTSRVLLLTDTTHSIPVQVNRNGLRA
IASGTGNPERLELRHVADTADIKEGDLLVSSGLGQRFPAGYPVATVKEVIHDSGQPFAIV
RAVPTAALNRSRYLLLVFSDNRTAEERVNAAAQAQESLDAQGGGPIIPSTVPKPVSPAVP
AAPAAALAIPATAAPAVTAPAKPTTTPAKPAAATKPPAAQPAAAKPAAKPPVSAPATPVG
RE