Protein Info for PfGW456L13_4985 in Pseudomonas fluorescens GW456-L13

Annotation: Glycosyl transferase, group 1 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 PF13439: Glyco_transf_4" amino acids 18 to 184 (167 residues), 100.5 bits, see alignment E=3.3e-32 PF13579: Glyco_trans_4_4" amino acids 19 to 173 (155 residues), 60.2 bits, see alignment E=9.9e-20 PF00534: Glycos_transf_1" amino acids 195 to 356 (162 residues), 96.7 bits, see alignment E=3.5e-31 PF20706: GT4-conflict" amino acids 203 to 366 (164 residues), 28.2 bits, see alignment E=2.9e-10 PF13692: Glyco_trans_1_4" amino acids 208 to 342 (135 residues), 93.9 bits, see alignment E=3.3e-30

Best Hits

KEGG orthology group: None (inferred from 88% identity to pfo:Pfl01_0885)

Predicted SEED Role

"Glycosyl transferase, group 1 family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QWY9 at UniProt or InterPro

Protein Sequence (391 amino acids)

>PfGW456L13_4985 Glycosyl transferase, group 1 family protein (Pseudomonas fluorescens GW456-L13)
MTTALHITLITETFPPEINGVANTLGRLCDGLRARGHQVELVRPRQGCDQQLASDDELLL
CRGWPLPGYPGLQWGQSSMHKLLRRWTRHRPDVLYIATEGPLGLSALRAARRLGISVVSG
FHTNFQQYSNQYGLGLLTRLLTHYLRWFHNRSTMTLVPSVSQRMELERRHFERLALLSRG
VDSELFHPAKRLNALREQWGLAEADIAVIHVGRLAPEKNLGLLKRTFNTLKASYPQRTLK
LVVVGDGPQRQELENEMPEAIFCGTQRGEALACHYASGDVFLFPSLTETFGNVVLEALAS
GLGVVAYDQAAAAQHIRHGYNGVLAMPGDEEAFCDAAAWLLEEREALRNVRLNARQHASR
QGWATIIEQFEGQLRGACAGEMVLPNAPTVP