Protein Info for PfGW456L13_4787 in Pseudomonas fluorescens GW456-L13

Annotation: Bactoprenol glucosyl transferase GtrB (EC 2.4.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 228 to 249 (22 residues), see Phobius details amino acids 261 to 286 (26 residues), see Phobius details PF00535: Glycos_transf_2" amino acids 4 to 165 (162 residues), 106.6 bits, see alignment E=1.4e-34 PF10111: Glyco_tranf_2_2" amino acids 4 to 94 (91 residues), 27.7 bits, see alignment E=2e-10

Best Hits

Swiss-Prot: 65% identical to GTRB_BPSF5: Bactoprenol glucosyl transferase (gtrB) from Shigella phage SfV

KEGG orthology group: None (inferred from 66% identity to ppw:PputW619_0863)

MetaCyc: 62% identical to CPS-53 (KpLE1) prophage; bactoprenol glucosyl transferase (Escherichia coli K-12 substr. MG1655)
Phosphopolyprenol glucosyltransferase. [EC: 2.4.1.78]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.78

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QWB7 at UniProt or InterPro

Protein Sequence (313 amino acids)

>PfGW456L13_4787 Bactoprenol glucosyl transferase GtrB (EC 2.4.1.-) (Pseudomonas fluorescens GW456-L13)
MKISLIVPVFNEEQSINLFYQAVRRELRLGDTEVEIVFINDGSSDNTAEQAMALAQADDQ
VMLINFSRNFGKEPALFAGLEHASGDAVIPMDVDLQDPINVIPLLIEQWQKGADVVLAKR
RNRAADGYLRRHSASIFYRVLNRIAYTRIEENVGDFRLMDRKVVDVIRSLPEHQLFMKGV
LSWAGFNTVVVEFERPGRVVGSSKFNVWKLWNLALEGVTSFSTVPLRLWTYVGGGISMFA
VLYAVYMVLDKIFFGNSVPGYPSLMTAILFLGGVQLIGIGILGEYIGRIYIEAKHRPRYV
IKDIVGGKDRGGR