Protein Info for PfGW456L13_470 in Pseudomonas fluorescens GW456-L13

Annotation: MotA/TolQ/ExbB proton channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 transmembrane" amino acids 14 to 34 (21 residues), see Phobius details amino acids 122 to 144 (23 residues), see Phobius details amino acids 165 to 189 (25 residues), see Phobius details PF01618: MotA_ExbB" amino acids 95 to 198 (104 residues), 113.2 bits, see alignment E=3.5e-37

Best Hits

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 96% identity to pfo:Pfl01_0219)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QJ60 at UniProt or InterPro

Protein Sequence (241 amino acids)

>PfGW456L13_470 MotA/TolQ/ExbB proton channel family protein (Pseudomonas fluorescens GW456-L13)
MTLLASPLESIESAVIWLLVVFSVATWGLALLKGVQFGRLKAQDRKFHQQFWAASSLDSA
AELSETRPGAAARVAQAGYAAIQVGEAPQAADLSQAINHQDRLERALRQQIVRERRSLET
GLAVLASIGSTSPFIGLFGTVWGIMEALKGISAAGSASLETVAGPIGAALVATGVGIAVA
VPAVLVYNYFLRRLKLTAADLDDFAHDFYSLAQKSSFRVLIHPTAHKVAAQGSVQKVKEA
S