Protein Info for PfGW456L13_4617 in Pseudomonas fluorescens GW456-L13

Annotation: Na+/H+ antiporter NhaA type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 61 to 80 (20 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 128 to 146 (19 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 212 to 241 (30 residues), see Phobius details amino acids 261 to 282 (22 residues), see Phobius details amino acids 293 to 315 (23 residues), see Phobius details amino acids 328 to 353 (26 residues), see Phobius details amino acids 366 to 386 (21 residues), see Phobius details PF06965: Na_H_antiport_1" amino acids 9 to 382 (374 residues), 495.4 bits, see alignment E=4.9e-153 TIGR00773: Na+/H+ antiporter NhaA" amino acids 10 to 381 (372 residues), 513.7 bits, see alignment E=1.5e-158

Best Hits

Swiss-Prot: 93% identical to NHAA_PSEPF: Na(+)/H(+) antiporter NhaA (nhaA) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03313, Na+:H+ antiporter, NhaA family (inferred from 93% identity to pfo:Pfl01_1234)

MetaCyc: 58% identical to Na+:H+ antiporter NhaA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-129; TRANS-RXN-292

Predicted SEED Role

"Na+/H+ antiporter NhaA type" in subsystem Na(+) H(+) antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QQU5 at UniProt or InterPro

Protein Sequence (395 amino acids)

>PfGW456L13_4617 Na+/H+ antiporter NhaA type (Pseudomonas fluorescens GW456-L13)
LPLRSTFTRFFQLEAASGLLLIAAAVLALIINNSPLSWLYNGLLDTPVVAQIGALKIAKP
LLLWINDGLMALFFLLIGLEVKREVLDGQLSKPSQIVLPGAAAIGGMVVPALIYWYLNRD
TPAALNGWAIPTATDIAFALGVLALLGKRVPVSLKLFLMTLAIIDDLGAIIIIAIFYSGA
LSTLSLALAATCIAALIGMNRLGVVKLGPYMIIGLILWVCVLKSGVHATLAGVTLAFCIP
LRTKNAEPSPLLALEHALHPWVAYGILPLFAFANAGLSLSGVTVESFTHHVPMGIAIGLL
LGKTVGVFGLTWLAVKTGIAALPQGANWGQILGVAILCGIGFTMSLFVGSLAFEPGVSDF
AGMDRMGILTGSILAALIGYVVTAMASRKNSALAS