Protein Info for PfGW456L13_4368 in Pseudomonas fluorescens GW456-L13

Annotation: N-Acetylneuraminate cytidylyltransferase (EC 2.7.7.43)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 PF02348: CTP_transf_3" amino acids 6 to 137 (132 residues), 99.8 bits, see alignment E=2e-32 TIGR03584: pseudaminic acid cytidylyltransferase" amino acids 6 to 228 (223 residues), 331.2 bits, see alignment E=1.5e-103 PF12804: NTP_transf_3" amino acids 8 to 139 (132 residues), 30.2 bits, see alignment E=4.9e-11

Best Hits

Swiss-Prot: 46% identical to PSEF_CAMJJ: Pseudaminic acid cytidylyltransferase (pseF) from Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)

KEGG orthology group: K00983, N-acylneuraminate cytidylyltransferase [EC: 2.7.7.43] (inferred from 80% identity to pfo:Pfl01_1521)

Predicted SEED Role

"N-Acetylneuraminate cytidylyltransferase (EC 2.7.7.43)" in subsystem CMP-N-acetylneuraminate Biosynthesis or Sialic Acid Metabolism (EC 2.7.7.43)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QX71 at UniProt or InterPro

Protein Sequence (237 amino acids)

>PfGW456L13_4368 N-Acetylneuraminate cytidylyltransferase (EC 2.7.7.43) (Pseudomonas fluorescens GW456-L13)
MPLNNVAIIPARGGSKRIPRKNLKPFAGVPMIARSIQVALESGLFSRVVVSTDDEEIAGL
ARDCGAQVPFMRPAALADDFTGTAAVIAHALQALREQGDEFDRACCIYATAPLLQSRFLA
QGLSLLEQHPDKSFAFSVCDFGFPVQRALTLDDQGALTALYPQYRDTRSQDLSIAYQDAG
QFYWGRSDAWLRGEVLYSPYSLPVILPRHLVQDIDTPQDWKRAEYLYAALKAGGELQ