Protein Info for PfGW456L13_4300 in Pseudomonas fluorescens GW456-L13

Annotation: Eukaryotic-type low-affinity urea transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 transmembrane" amino acids 53 to 81 (29 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 186 to 208 (23 residues), see Phobius details amino acids 213 to 230 (18 residues), see Phobius details amino acids 236 to 254 (19 residues), see Phobius details amino acids 262 to 294 (33 residues), see Phobius details PF03253: UT" amino acids 34 to 296 (263 residues), 166.1 bits, see alignment E=5.2e-53

Best Hits

KEGG orthology group: K08717, urea transporter (inferred from 76% identity to pfo:Pfl01_1593)

Predicted SEED Role

"Eukaryotic-type low-affinity urea transporter" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QTV9 at UniProt or InterPro

Protein Sequence (323 amino acids)

>PfGW456L13_4300 Eukaryotic-type low-affinity urea transporter (Pseudomonas fluorescens GW456-L13)
VSELARDAGNPVPLTFRPAMPANHFNTHCPDWAEALLNGFSQIFLQRNPLCGLLCVLAIL
FTAPALLGGALLGGVAGLLTAQRRNYAKADRQAGLFSYNGVLLGLLLSLYFPWSAMMPPL
ILAAGGLSAMVTQQWLKRVRFSQYLPAYTAPFVGLGWLLLCFTTPSTEPHLIEVSTLNML
AAPLKGLGQVMFLGHPLAGAMIAAGLLIADRRAFCWALLASVAGMGWSLLNHDFYTALLG
LGGYNAVLVALAFSSQRRQPWLPLVGIGLALLLTPLFAAIGLPTLTAPFILAGWLIRSVV
QMLGRATVESTPCATGENQPRLR