Protein Info for PfGW456L13_4220 in Pseudomonas fluorescens GW456-L13

Annotation: C4-dicarboxylate transporter/malic acid transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 transmembrane" amino acids 31 to 50 (20 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 97 to 121 (25 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 199 to 222 (24 residues), see Phobius details amino acids 235 to 256 (22 residues), see Phobius details amino acids 275 to 301 (27 residues), see Phobius details amino acids 312 to 332 (21 residues), see Phobius details amino acids 338 to 359 (22 residues), see Phobius details PF03595: SLAC1" amino acids 26 to 364 (339 residues), 319.3 bits, see alignment E=1.5e-99

Best Hits

KEGG orthology group: None (inferred from 91% identity to pfo:Pfl01_1664)

Predicted SEED Role

"C4-dicarboxylate transporter/malic acid transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QPS2 at UniProt or InterPro

Protein Sequence (383 amino acids)

>PfGW456L13_4220 C4-dicarboxylate transporter/malic acid transport protein (Pseudomonas fluorescens GW456-L13)
MTCANSIKPGIKPFSHLQHPREVIRQFTPNWFAATMGTGVLALALAQLPVATPALHAFAE
ALWLFNIALFLLFTVLYTARWVLFFDEARRIFGHSTVSMFFGTIPMGLATIINGFLVFGL
PRWGEGVIHLAEVLWWLDVVMSLACGVLIPYMMFTRQEHSIDQMTAVWLLPVVAAEVAAA
SGGLLAPHLADAHSQLVVLVTSYVLWAFSLPVAFSILTILLLRMALHKLPHENMAASSWL
ALGPIGTGALGMLVLGGDAPLIFAANGMPGIGEIAAGLGLVAGITLWGFGLWWMLMALLI
TVRYLRAGIPFNLGWWGFTFPLGVYSLATLKLASTLNLMFFSVFGCVLVALLAVMWLIVG
KRTVLGAWRGELFVSPCIAGLKK