Protein Info for PfGW456L13_4191 in Pseudomonas fluorescens GW456-L13

Annotation: Septum site-determining protein MinC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 TIGR01222: septum site-determining protein MinC" amino acids 15 to 248 (234 residues), 270.3 bits, see alignment E=7.4e-85 PF05209: MinC_N" amino acids 16 to 87 (72 residues), 68.7 bits, see alignment E=3.7e-23 PF03775: MinC_C" amino acids 144 to 245 (102 residues), 105.9 bits, see alignment E=9.9e-35

Best Hits

Swiss-Prot: 90% identical to MINC_PSEPF: Probable septum site-determining protein MinC (minC) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03610, septum site-determining protein MinC (inferred from 92% identity to pfl:PFL_4379)

Predicted SEED Role

"Septum site-determining protein MinC" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QXG8 at UniProt or InterPro

Protein Sequence (248 amino acids)

>PfGW456L13_4191 Septum site-determining protein MinC (Pseudomonas fluorescens GW456-L13)
MPTMSQTEPQDQDPVFQLKGSMLAITVLELARNDLESLDRQLAAKVAQAPNFFSNAPLVL
ALDKLPANGGAVDLPGLMRVCRQHGLRTLAIRASRIEDIAAAIAVDLPVLPPSGARERPL
DLTEGEPKKKPEKPPEPTIKPTKIITSPVRGGQQIYAQGSDLVVISSVSPGAELLADGNI
HVYGPMRGRVLAGVKGDTKARIFCQQMSAELISIAGHYKVSEDLRRDPLWGSGVQVSLSG
DVLNIIRL