Protein Info for PfGW456L13_4076 in Pseudomonas fluorescens GW456-L13

Annotation: FIG000557: hypothetical protein co-occurring with RecR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 112 TIGR00103: DNA-binding protein, YbaB/EbfC family" amino acids 3 to 108 (106 residues), 111.9 bits, see alignment E=7.3e-37 PF02575: YbaB_DNA_bd" amino acids 10 to 102 (93 residues), 116.1 bits, see alignment E=3.3e-38

Best Hits

Swiss-Prot: 86% identical to Y1905_PSEF5: Nucleoid-associated protein PFL_1905 (PFL_1905) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K09747, hypothetical protein (inferred from 90% identity to pba:PSEBR_a1713)

Predicted SEED Role

"FIG000557: hypothetical protein co-occurring with RecR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0F4SQX7 at UniProt or InterPro

Protein Sequence (112 amino acids)

>PfGW456L13_4076 FIG000557: hypothetical protein co-occurring with RecR (Pseudomonas fluorescens GW456-L13)
MMKGGMAGLMKQAQQMQEKMAKMQEELANAEVTGKAGGDMVTVVMTGRHDVKSVTIDPSL
VEGMSEDDKEMLEAVIASAVNDAVRKIEANSQDKMGSMTAGMQLPPGMKLPF