Protein Info for PfGW456L13_3803 in Pseudomonas fluorescens GW456-L13

Annotation: Cytosine/purine/uracil/thiamine/allantoin permease family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 23 to 44 (22 residues), see Phobius details amino acids 50 to 69 (20 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 190 to 208 (19 residues), see Phobius details amino acids 228 to 253 (26 residues), see Phobius details amino acids 264 to 293 (30 residues), see Phobius details amino acids 316 to 334 (19 residues), see Phobius details amino acids 340 to 365 (26 residues), see Phobius details amino acids 386 to 411 (26 residues), see Phobius details amino acids 423 to 439 (17 residues), see Phobius details PF02133: Transp_cyt_pur" amino acids 11 to 428 (418 residues), 254.7 bits, see alignment E=8.4e-80

Best Hits

Swiss-Prot: 59% identical to YXLA_BACSU: Putative purine-cytosine permease YxlA (yxlA) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 73% identity to pba:PSEBR_a2113)

Predicted SEED Role

"Cytosine/purine/uracil/thiamine/allantoin permease family protein" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QNL4 at UniProt or InterPro

Protein Sequence (454 amino acids)

>PfGW456L13_3803 Cytosine/purine/uracil/thiamine/allantoin permease family protein (Pseudomonas fluorescens GW456-L13)
MQVEKRSIDFIPETERHGKPGSLFYIWFGANMNITTIASGVLPVVMGLNLFWSALAIIIG
SLLGAIFMASHSAQGPKLGIPQMIQSRAQFGVLGAVLPLLFVMLIYLGFFVSNTLLAAQA
LESVSPLPMSGNIYLIGALCFVVALYGYRLIHRLQKLLSILSLVVFVAATVLALQLPIPA
EQWLPTGFSLSKFLVAVSIAVTWQLSYAPYVADYSRYLPSNTPTAQVFWYSYAGTVSGGA
WMMILGAILSVGIGDFSSNVGGHVAGLFGAGAVLLFAFIVYGQVSINVFNLYGAFMSTIT
VIEPFARLKVTPRVRGVFMLLISLVATALCTISQDDFISFFLNFIFFMSYFLIPWTAINL
VDYYCLRKGQYRIDDIFDLNGIYGRVNRIACGSFLLAIALEIPFMNTTLYVGPVATALDG
VDLAWIVGLLVPALSYYWLMKLGKRAPMMESAAD