Protein Info for PfGW456L13_3541 in Pseudomonas fluorescens GW456-L13

Updated annotation (from data): branched-chain alpha-ketoacid dehydrogenase, E1 component beta subunit (EC 1.2.4.4)
Rationale: Specifically important for utilizing L-Isoleucine.
Original annotation: Branched-chain alpha-keto acid dehydrogenase, E1 component, beta subunit (EC 1.2.4.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 PF02779: Transket_pyr" amino acids 18 to 193 (176 residues), 137.9 bits, see alignment E=2.9e-44 PF02780: Transketolase_C" amino acids 227 to 342 (116 residues), 127.9 bits, see alignment E=2.2e-41

Best Hits

Swiss-Prot: 91% identical to ODBB_PSEPU: 2-oxoisovalerate dehydrogenase subunit beta (bkdA2) from Pseudomonas putida

KEGG orthology group: K00167, 2-oxoisovalerate dehydrogenase E1 component, beta subunit [EC: 1.2.4.4] (inferred from 94% identity to pfl:PFL_2533)

Predicted SEED Role

"Branched-chain alpha-keto acid dehydrogenase, E1 component, beta subunit (EC 1.2.4.4)" in subsystem Isoleucine degradation or Leucine Degradation and HMG-CoA Metabolism or Valine degradation (EC 1.2.4.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.4.4

Use Curated BLAST to search for 1.2.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QQR8 at UniProt or InterPro

Protein Sequence (352 amino acids)

>PfGW456L13_3541 branched-chain alpha-ketoacid dehydrogenase, E1 component beta subunit (EC 1.2.4.4) (Pseudomonas fluorescens GW456-L13)
MNDHNNNIELETAMTTTTMTMIQALRSAMDVMLERDDNVVVFGQDVGYFGGVFRCTEGLQ
AKYGTSRVFDAPISESGIVGTAVGMGAYGLRPVVEIQFADYVYPAYDQIISEAARLRYRS
AGEFTAPMTLRMPCGGGIYGGQTHSQSIEALFTQVCGLRTVMPSNPYDAKGLLIASIEND
DPVIFLEPKRLYNGPFDGHHERPVTPWSKHPAAQVPDGYYTVPLDVAAIARPGKDVTVLT
YGTTVYVSQVAAEESGVDAEVIDLRSLWPLDLETITKSVKKTGRCVIVHEATRTCGFGAE
LTALVQEHCFHYLEAPIERVTGWDTPYPHAQEWAYFPGPSRVGAALKRVMEV