Protein Info for PfGW456L13_3403 in Pseudomonas fluorescens GW456-L13

Annotation: Biphenyl dioxygenase beta subunit (EC 1.14.12.18)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 PF00866: Ring_hydroxyl_B" amino acids 40 to 182 (143 residues), 121.5 bits, see alignment E=1.5e-39

Best Hits

Swiss-Prot: 40% identical to BPHE_PARXL: Biphenyl dioxygenase subunit beta (bphE) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K00470, [EC: 1.14.1.-] (inferred from 58% identity to bxe:Bxe_C0587)

MetaCyc: 36% identical to benzene 1,2 dioxygenase terminal oxygenase component beta subunit (Pseudomonas sp. ML2)
Benzene 1,2-dioxygenase. [EC: 1.14.12.3]

Predicted SEED Role

"Biphenyl dioxygenase beta subunit (EC 1.14.12.18)" in subsystem Biphenyl Degradation (EC 1.14.12.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.18

Use Curated BLAST to search for 1.14.1.- or 1.14.12.18 or 1.14.12.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QMH3 at UniProt or InterPro

Protein Sequence (191 amino acids)

>PfGW456L13_3403 Biphenyl dioxygenase beta subunit (EC 1.14.12.18) (Pseudomonas fluorescens GW456-L13)
MAQVQQRGVEDIQPGSPVGTKRVPVGSPIYNDVVTFLYEEATLLDQIRLQEWAERLDTDL
VYTVPLRQTRVASELRTTIVRSVQHYHDDYRSIMGRILRLSGKSAWAEDPPSRTRRLVTN
VFVEETDKSDEFVVTSYLLLTRSRFNDHHVDIISGERRDVLRLHEAGFKLSRREVILDQA
VLGTPNLAVFL