Protein Info for PfGW456L13_3186 in Pseudomonas fluorescens GW456-L13

Annotation: Transcriptional regulator, AraC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 PF00165: HTH_AraC" amino acids 181 to 214 (34 residues), 29.1 bits, see alignment 8.6e-11 amino acids 230 to 265 (36 residues), 35.5 bits, see alignment 8.2e-13 PF12833: HTH_18" amino acids 188 to 265 (78 residues), 80.6 bits, see alignment E=8.6e-27

Best Hits

KEGG orthology group: None (inferred from 80% identity to pba:PSEBR_a2477)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>PfGW456L13_3186 Transcriptional regulator, AraC family (Pseudomonas fluorescens GW456-L13)
MSHRNRPPPPRLSEPVRRIEAGPWAIELLPGCAYATRYVATQAGIGFAFDSQRGLHAIGS
DRIRPFDAVPNGLAFVPAGCDVLSESPQGGEYLRVIRTDGMALMGDRAFNNRIDRQATAL
AWRMRAALLLSSVEDDWEAWALALSERATGSEAVSTTPHGSITGSRMRLLDEFIDAGLED
PLSVPAMAGLLGLSEGYFMRAFKNATGKSPHSYLIDRRLAKARALMRDSTATLTEIAYAC
GFNSQAHMATTFKQRLGVSPAQLRQSLGLEQIDSESHAKADLLGVAKRN