Protein Info for PfGW456L13_3116 in Pseudomonas fluorescens GW456-L13

Annotation: FMN-dependent NADH-azoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 PF02525: Flavodoxin_2" amino acids 3 to 202 (200 residues), 141 bits, see alignment E=4.1e-45 PF03358: FMN_red" amino acids 5 to 124 (120 residues), 42.8 bits, see alignment E=4.2e-15

Best Hits

Swiss-Prot: 53% identical to AZOR2_COLP3: FMN-dependent NADH-azoreductase 2 (azoR2) from Colwellia psychrerythraea (strain 34H / ATCC BAA-681)

KEGG orthology group: K01118, FMN-dependent NADH-azoreductase [EC: 1.7.-.-] (inferred from 70% identity to rlg:Rleg_5707)

Predicted SEED Role

"FMN-dependent NADH-azoreductase"

Isozymes

Compare fitness of predicted isozymes for: 1.7.-.-

Use Curated BLAST to search for 1.7.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QR53 at UniProt or InterPro

Protein Sequence (222 amino acids)

>PfGW456L13_3116 FMN-dependent NADH-azoreductase (Pseudomonas fluorescens GW456-L13)
MTTLLHIDASARSDRSLSRKLSQAFVEAWVDRDDKTQVIVRDVGHNPPPFVTEAWIAAVF
TPEEHMTPEKREEIRLSDELIDEIDRADVIIMGTPMYNYGMPAALKSWFDKVIRIGKTFT
FDLDRGDYPLEPIMNGKKLVILSSRGEFGFGPGGVREAMNHLDTHIQTCAHYLGVNETHV
ISIDYQEFGDARHEASIADAFDAIPVLVRQLVEDRQRQLLPA