Protein Info for PfGW456L13_3088 in Pseudomonas fluorescens GW456-L13

Annotation: Two-component hybrid sensor and regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 638 TIGR00229: PAS domain S-box protein" amino acids 13 to 135 (123 residues), 77.5 bits, see alignment E=4.7e-26 amino acids 138 to 265 (128 residues), 75.9 bits, see alignment E=1.6e-25 PF00989: PAS" amino acids 15 to 122 (108 residues), 53.1 bits, see alignment E=1.2e-17 amino acids 143 to 255 (113 residues), 42.5 bits, see alignment E=2.3e-14 PF13426: PAS_9" amino acids 27 to 129 (103 residues), 57 bits, see alignment E=8.3e-19 amino acids 155 to 257 (103 residues), 54.8 bits, see alignment E=3.9e-18 PF08448: PAS_4" amino acids 27 to 131 (105 residues), 41.5 bits, see alignment E=5.5e-14 amino acids 155 to 258 (104 residues), 30.3 bits, see alignment E=1.7e-10 PF08447: PAS_3" amino acids 38 to 122 (85 residues), 29.8 bits, see alignment E=2.3e-10 PF00512: HisKA" amino acids 282 to 345 (64 residues), 32.1 bits, see alignment E=3.9e-11 PF02518: HATPase_c" amino acids 388 to 505 (118 residues), 66.8 bits, see alignment E=9e-22 PF00072: Response_reg" amino acids 527 to 631 (105 residues), 61 bits, see alignment E=4.8e-20

Best Hits

KEGG orthology group: K00936, [EC: 2.7.3.-] (inferred from 81% identity to pfo:Pfl01_2691)

Predicted SEED Role

"Two-component hybrid sensor and regulator"

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QP38 at UniProt or InterPro

Protein Sequence (638 amino acids)

>PfGW456L13_3088 Two-component hybrid sensor and regulator (Pseudomonas fluorescens GW456-L13)
MSEDRNRPSTVEDKRFRLLIDAVIDYAIYMIDPDGIITSWNAGARRFKGYEEAEILGQHF
SRFYTDDDRRAGLPQRALDTAIREGRFEGEGWRVRKDGTHFWCHVVIDPIFDPSGTLLGF
AKITRDLTDRKMAEEILKQSEQQFRLLVQSVTDYAIYMLSPDGRVSNWNPGAQRIKGYLP
EEVIGRHFSMFYTPEDRDAREPQRTLDIAVREGRFENKGWRMRKDGTRFLAHVIVDPIWG
DTGTLLGFAKITRDITEVTQAQQALEQTREALFQAQKMQAIGQLSGGIAHDFNNLLTVIL
GNLEIVRKRVTDDPKITRLIDNATQGALRGVSLTQRMLAFARRQELKSVPVRIPALVEGI
SGLLRSSLGPSVKVETRFPEDLEPVMADINQLELAVLNLATNARDAMPHGGTIIFSARTE
EVTGGASSLAAGRYVCLNIADTGEGMDETTLASAMDPFFTTKGVGKGTGLGLSMVHGFIE
QLGGRFILKSNKDQGTTAELWLPVATRGSVAEPVAQTQTVEVPRLCVLVVDDDSLVLTST
SLLLEDLGHRVISAPSGARALELFGSEPDIDLVITDMAMPQMSGAQLANAIRLIRPSVPI
ILATGFAERLEGIAERLPRLSKPFTQLNLVEVIALAMK