Protein Info for PfGW456L13_3041 in Pseudomonas fluorescens GW456-L13

Annotation: Various polyols ABC transporter, permease component 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 16 to 41 (26 residues), see Phobius details amino acids 78 to 100 (23 residues), see Phobius details amino acids 111 to 130 (20 residues), see Phobius details amino acids 160 to 183 (24 residues), see Phobius details amino acids 218 to 238 (21 residues), see Phobius details amino acids 268 to 289 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 106 to 294 (189 residues), 48.4 bits, see alignment E=4.9e-17

Best Hits

Swiss-Prot: 35% identical to Y4OQ_SINFN: Probable ABC transporter permease protein y4oQ (NGR_a02190) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K10228, sorbitol/mannitol transport system permease protein (inferred from 97% identity to pfo:Pfl01_2639)

MetaCyc: 94% identical to polyol ABC-type transporter permease component MtlF (Pseudomonas fluorescens)
7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]

Predicted SEED Role

"Various polyols ABC transporter, permease component 1" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0F4TJM5 at UniProt or InterPro

Protein Sequence (299 amino acids)

>PfGW456L13_3041 Various polyols ABC transporter, permease component 1 (Pseudomonas fluorescens GW456-L13)
MDIAQPQRKSRVANPGWFLVSPSVALLLLWMIVPLGMTVYFSTIRYNLLNPGENEFVGLE
NFTYFLTDSGFLPGATNTLLLVGSVLLISVVFGVLISALLEASEFFGRGIVRVMLISPFF
IMPTVGALIWKNLIFHPVSGILAYVWKLFGAQPVDWLAHYPLLSIIIIVSWQWLPFAILI
LMTAMQSLDQEQKEAARLDGAGPIAIFWHLTLPHLARPIAVVVMIETIFLLSVFAEIFTT
TNGGPGYASTNLAYLIYNQALVQFDVGMASAGGLIAVVIANIAAIILVRMIGKNLTDKA