Protein Info for PfGW456L13_292 in Pseudomonas fluorescens GW456-L13

Annotation: Polyhydroxyalkanoic acid synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01839: poly(R)-hydroxyalkanoic acid synthase, class II
  • amino acids 1 to 559 (559 residues), 1037.7 bits, E=0
• PF07167: PhaC_N
  • amino acids 75 to 243 (169 residues), 216 bits, E=3e-68
• PF00561: Abhydrolase_1
  • amino acids 235 to 486 (252 residues), 98 bits, E=7.3e-32

Best Hits

Swiss-Prot: 83% identical to PHAC1_PSEOL: Poly(3-hydroxyalkanoate) polymerase 1 (phaC1) from Pseudomonas oleovorans

KEGG orthology group: K03821, polyhydroxyalkanoate synthase [EC: 2.3.1.-] (inferred from 92% identity to pfo:Pfl01_0394)

MetaCyc: 82% identical to poly[R)-3-hydroxydecanoate polymerase (Pseudomonas putida GPo1)
RXN-11796 [EC: 2.3.1.304]

Predicted SEED Role

"Polyhydroxyalkanoic acid synthase" in subsystem Polyhydroxybutyrate metabolism

MetaCyc Pathways

• polyhydroxybutanoate biosynthesis (2/3 steps found)
• polyhydroxydecanoate biosynthesis (2/3 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.304

Sequence Analysis Tools

See A0A293PWI3 at UniProt or InterPro

Protein Sequence (559 amino acids)

>PfGW456L13_292 Polyhydroxyalkanoic acid synthase (Pseudomonas fluorescens GW456-L13)
MSNKNNDDLKSQASENTLGLNPVVGLRGKDLLASARMVLRQAIKQPIHSARHVAHFGLEL
KNVLLGKSELLPTSDDRRFADPAWSQNPLYKRYLQTYLAWRKELHDWIDDSNLPAKDVSR
GHFVINLMTEAFAPTNTAANPAAVKRFFETGGKSLLDGLSHLAKDLVHNGGMPSQVNMGA
FEVGKTLGVTEGAVVFRNDVLELIQYKPITEQVHERPLLVVPPQINKFYVFDLSPEKSLA
RFCLRNNMQTFIVSWRNPTKEQREWGLSTYIEALKEAVDVVTAITGSKDVNMLGACSGGI
TCTALLGHYAAIGENKVNALTLLVSVLDTTLDSDVALFVDEQTLEAAKRQSYQAGVLEGR
DMAKVFAWMRPNDLIWNYWVNNYLLGNEPPVFDILFWNNDTTRLPAAFHGDLIEMFKSNP
LTRADALEVCGTPIDLKKVTADIFSLAGTSDHITPWRSCYKSAQLFGGNVEFVLSSSGHI
QSILNPPGNPKSRYMTSTEMPANADDWQEESTKHADSWWLHWQAWQAQRSGNLKKAPLKL
GNKAYPAGEAAPGTYVHER