Protein Info for PfGW456L13_2828 in Pseudomonas fluorescens GW456-L13

Annotation: Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 66 to 91 (26 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details amino acids 181 to 200 (20 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details amino acids 235 to 256 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 81 to 255 (175 residues), 65.1 bits, see alignment E=3.7e-22

Best Hits

Swiss-Prot: 44% identical to POTC_HAEIN: Spermidine/putrescine transport system permease protein PotC (potC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 96% identity to pfo:Pfl01_3144)

MetaCyc: 42% identical to spermidine preferential ABC transporter membrane subunit PotC (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]; 7.6.2.11 [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1)" in subsystem Polyamine Metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QNF8 at UniProt or InterPro

Protein Sequence (262 amino acids)

>PfGW456L13_2828 Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1) (Pseudomonas fluorescens GW456-L13)
MIALHLKKLPLTREVSLLMLAYLYLPIFVLIAYSFNANRSATVWTEFSFDWYGRILANPS
IQTAALNSIIVASIATVCATAIALLAALATYRPFYGQKMVEGGINLPLILPEIVTAVATL
LLFMALGIKLGLLTVIVAHIGFCIPFAYLPIRARLNDLDKSLLEAANDLYANPWQVFRRV
TLPLLWPAVLSGSVLAFVVSLDDFIMTFFVAGPGSTTLPVYIFSAIKAGVTPEINAISTL
MLVISIVLVVLAFWLGQRGKQQ