Protein Info for PfGW456L13_2701 in Pseudomonas fluorescens GW456-L13

Annotation: Cytochrome c2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 129 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00034: Cytochrom_C" amino acids 28 to 125 (98 residues), 38.4 bits, see alignment E=1.3e-13

Best Hits

Swiss-Prot: 41% identical to C554_METTR: Cytochrome c-554 (MettrDRAFT_3796) from Methylosinus trichosporium

KEGG orthology group: K08738, cytochrome c (inferred from 71% identity to pfo:Pfl01_3552)

MetaCyc: 46% identical to cytochrome c2 (Agrobacterium fabrum)

Predicted SEED Role

"Cytochrome c2" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293Q0H1 at UniProt or InterPro

Protein Sequence (129 amino acids)

>PfGW456L13_2701 Cytochrome c2 (Pseudomonas fluorescens GW456-L13)
MKKLAALTLASALTAGLFSTPTLAAGDVQAGEKVYKRLCSGCHQIGESARAFFGPQLNGV
IGRHSAVTTDYVYSDAMKSANLVWDRETLIAYLEAPKKVVPGTRMIFWGLSDPEKIEDLL
AYLQTFPAQ