Protein Info for PfGW456L13_2627 in Pseudomonas fluorescens GW456-L13

Annotation: NADH-ubiquinone oxidoreductase chain H (EC 1.6.5.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 52 to 69 (18 residues), see Phobius details amino acids 81 to 103 (23 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details amino acids 238 to 261 (24 residues), see Phobius details amino acids 273 to 291 (19 residues), see Phobius details amino acids 309 to 329 (21 residues), see Phobius details PF00146: NADHdh" amino acids 17 to 322 (306 residues), 396 bits, see alignment E=5.9e-123

Best Hits

Swiss-Prot: 92% identical to NUOH_PSEPF: NADH-quinone oxidoreductase subunit H (nuoH) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K00337, NADH dehydrogenase I subunit H [EC: 1.6.5.3] (inferred from 90% identity to psb:Psyr_3203)

MetaCyc: 90% identical to NADH-quinone oxidoreductase subunit H (Pseudomonas putida KT2440)
NADH-DEHYDROG-A-RXN [EC: 7.1.1.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain H (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3 or 7.1.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QPA6 at UniProt or InterPro

Protein Sequence (335 amino acids)

>PfGW456L13_2627 NADH-ubiquinone oxidoreductase chain H (EC 1.6.5.3) (Pseudomonas fluorescens GW456-L13)
MTWFTPEVIDIIITILKAVVILLAVVVCGALLSWVERRLLALWQDRYGPNRVGPFGAFQI
AADMIKMFFKEDWTPPFADKMIFTLAPVVAMSALLIAFAIIPITPTWGVADINIGILFFF
AMAGLSVYAVLFAGWSSNNKFALLGSLRASAQTVSYEVFMGLSLMGIVIQVGSFNMRDIV
EYQAQNLWFIIPQIFGFLTFFIAGVAVTHRHPFDQPEAEQELADGYHIEYAGMKWGMFFV
GEYIGIVLISALLVTLFFGGWHGPFGILPQIPFIWFALKTAFFIMMFILLRASIPRPRYD
QVMDFSWKFCLPLTLVNMLVTAAIVLLNTPAVAAQ