Protein Info for PfGW456L13_2598 in Pseudomonas fluorescens GW456-L13

Annotation: Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF12727: PBP_like" amino acids 84 to 242 (159 residues), 29.1 bits, see alignment E=8.3e-11 PF12849: PBP_like_2" amino acids 86 to 297 (212 residues), 117 bits, see alignment E=2e-37 PF00691: OmpA" amino acids 345 to 439 (95 residues), 61.7 bits, see alignment E=1.1e-20

Best Hits

KEGG orthology group: K02040, phosphate transport system substrate-binding protein (inferred from 83% identity to pfo:Pfl01_3650)

Predicted SEED Role

"Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QMS0 at UniProt or InterPro

Protein Sequence (446 amino acids)

>PfGW456L13_2598 Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1) (Pseudomonas fluorescens GW456-L13)
MMLRVLFLLMLCTGLPQAASAGDLPTPEHGPALRIQGSNTIGAALGPALVEGLLSEQGLR
KIRRETPDTANELRIVGETVQGRRVVVEVAAHGSSTGFTALKAASADLAASSRPIKDSEL
ASLQSLGDLKSPSAEQVIAIDGLAIILHPDNPLNQLDTVQLARIFSGEVKSWEDIGGRGG
PIHLYARDDQSGTYDTFKELVLSGHGKTLGSAAKRFESSEQLSDAVSADPHGIGFIGLPY
VRQAKAVAIIDGQSQAMPPLNSLIATEDYPLSRRLFFYLPPNGKNPWANALVAFAQSTKG
QAIVAANGFIAQTVQAMAVTPNALMPEGYQALSRHAQRLSVNFRFEEGSATLDNKARQDL
WRVLDYIKQHDKTAGQVTLVGFGDAKSDPARADLLSKLRAMAVRRELVKSGVVFREIRGF
GAEMPVAANSADEGRIRNRRVEVWVY