Protein Info for PfGW456L13_2511 in Pseudomonas fluorescens GW456-L13

Annotation: short-chain dehydrogenase/reductase SDR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 PF00106: adh_short" amino acids 8 to 198 (191 residues), 169.7 bits, see alignment E=8.5e-54 PF08659: KR" amino acids 10 to 169 (160 residues), 49.2 bits, see alignment E=9e-17 PF13561: adh_short_C2" amino acids 13 to 227 (215 residues), 118 bits, see alignment E=7.9e-38

Best Hits

KEGG orthology group: None (inferred from 51% identity to ctt:CtCNB1_1727)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QPT4 at UniProt or InterPro

Protein Sequence (279 amino acids)

>PfGW456L13_2511 short-chain dehydrogenase/reductase SDR (Pseudomonas fluorescens GW456-L13)
MSNEQGPVAVITGAASGIGRGLAEHAATLGMRLVLADRDAAGLQALCDELKASGVQAIAC
VTDVGDVKQVERLRDRAVEHFGGVDLLFNNAGVMQTGFSWEITETQWQRMLDVNLNGVIN
GIRTFVPLLLSQGRAAHVINTASLAGLVSSPLMAPYNVTKQAVVALSETLHYELAMIGAP
VSVSVLCPGPVASEIMASNQVVDTAGSDFSQLLDSTIRQGMTPAELAAQVFAAIAQKRFW
ILPHKGFKPALERRVQSILGETNPQFQMADVEDDAHAAR