Protein Info for PfGW456L13_2124 in Pseudomonas fluorescens GW456-L13

Annotation: FIG00962766: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 49 to 67 (19 residues), see Phobius details amino acids 78 to 95 (18 residues), see Phobius details amino acids 101 to 126 (26 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details amino acids 161 to 184 (24 residues), see Phobius details amino acids 216 to 236 (21 residues), see Phobius details amino acids 248 to 271 (24 residues), see Phobius details amino acids 278 to 297 (20 residues), see Phobius details amino acids 303 to 326 (24 residues), see Phobius details amino acids 338 to 359 (22 residues), see Phobius details amino acids 367 to 389 (23 residues), see Phobius details PF07690: MFS_1" amino acids 20 to 351 (332 residues), 108 bits, see alignment E=2.6e-35

Best Hits

KEGG orthology group: None (inferred from 77% identity to pfl:PFL_1814)

Predicted SEED Role

"FIG00962766: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293PZ52 at UniProt or InterPro

Protein Sequence (401 amino acids)

>PfGW456L13_2124 FIG00962766: hypothetical protein (Pseudomonas fluorescens GW456-L13)
MPTATPPVSNKLFGLFCLASYLLSLSYGSTFLLSLLIGSRGGNEHDAGSVISAAMLSTFA
AVIVSGHLSDLLGAARSVALFGVLLVAASLGFALTPGFGHLLLFFGLLLGLGWGVFYTLG
PIIVASLVTPAQRARYFALLSGSMMTGIGSGPLLGRAASALGYPVTAAFYLAALASLIGV
LLFWRLDRQLKPAPAQSGSVSRISWRAAGQVLSSRAVFPIIMVGLGGSVFGGLSSFQTSY
AAARSLDYSLFFLGFMSAAISGRMLVAGFVVKRDPLRASCLLSGLMLASIVMFGFVVDSS
VSYVLAAVMLGIGYGLTYSVINGLAANEAPNGTTAQSLLLFSLSYFIGVFGFPLLAGKII
VEQGMPTLLLTVLAVASLNWLITVGRLIWRRATAVRALEEA