Protein Info for PfGW456L13_1917 in Pseudomonas fluorescens GW456-L13

Annotation: Fatty acid desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 26 to 44 (19 residues), see Phobius details amino acids 50 to 68 (19 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 148 to 164 (17 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details PF00487: FA_desaturase" amino acids 52 to 283 (232 residues), 112.6 bits, see alignment E=1.4e-36

Best Hits

KEGG orthology group: None (inferred from 84% identity to pfo:Pfl01_4347)

Predicted SEED Role

"Fatty acid desaturase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QN57 at UniProt or InterPro

Protein Sequence (313 amino acids)

>PfGW456L13_1917 Fatty acid desaturase (Pseudomonas fluorescens GW456-L13)
MPHYFDSAHQEEIETLRRRFTARTDWPTWLLLIGVYGGWFGIVLNSHRLGLWWSTLLLTP
LLVLWLSVQHELLHGHPTRWPTLNKILGYAPFAVWYPYTLYRDSHLQHHRDEDLTIPGRD
PESRYLSAGQWQGSSPLVRSLHWLNKTVLGRFSLGAPLALLALAREELQRLRAGERQAWL
MWLSHGLMTGLMLLFIANFSLLPVWHYLFLISVPALSIAMIRSYYEHRPHAAPEQRTVLN
EAAWPWRWLFLNLNFHLVHHELPGLPWYDLPRAYRARREQWLARSGGFLVRGYGQLWREH
GVKAIDSPRHPFY