Protein Info for PfGW456L13_1915 in Pseudomonas fluorescens GW456-L13

Annotation: Histone acetyltransferase HPA2 and related acetyltransferases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 PF00583: Acetyltransf_1" amino acids 19 to 106 (88 residues), 41.8 bits, see alignment E=1.8e-14 PF13673: Acetyltransf_10" amino acids 30 to 108 (79 residues), 35.5 bits, see alignment E=1.4e-12 PF13508: Acetyltransf_7" amino acids 33 to 107 (75 residues), 43.5 bits, see alignment E=5.2e-15

Best Hits

KEGG orthology group: None (inferred from 83% identity to pfo:Pfl01_4348)

Predicted SEED Role

"Histone acetyltransferase HPA2 and related acetyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QNG3 at UniProt or InterPro

Protein Sequence (138 amino acids)

>PfGW456L13_1915 Histone acetyltransferase HPA2 and related acetyltransferases (Pseudomonas fluorescens GW456-L13)
MPETRYTLLDEPLWPLMNKFYRAHQSSMKAVRDAQLWVARRDQIVAALCLRPVSGGHWLT
GLFVDPACREQGLAAGLIAAAVKDCEQPVWLFCHPDLRGFYERRGFTFDPPMPYAMVERL
SRYARSKPMIAMGLAPGV