Protein Info for PfGW456L13_1860 in Pseudomonas fluorescens GW456-L13

Annotation: TPR repeat containing exported protein; Putative periplasmic protein contains a protein prenylyltransferase domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 PF16331: TolA_bind_tri" amino acids 36 to 90 (55 residues), 35.9 bits, see alignment E=2.2e-12 TIGR02795: tol-pal system protein YbgF" amino acids 132 to 249 (118 residues), 135.3 bits, see alignment E=7.9e-44 PF13525: YfiO" amino acids 133 to 237 (105 residues), 34.5 bits, see alignment E=6.6e-12 PF13432: TPR_16" amino acids 136 to 201 (66 residues), 36.7 bits, see alignment E=1.8e-12 PF13174: TPR_6" amino acids 137 to 165 (29 residues), 16.7 bits, see alignment (E = 3.1e-06) amino acids 171 to 201 (31 residues), 17.9 bits, see alignment 1.3e-06 amino acids 207 to 238 (32 residues), 20.6 bits, see alignment 1.9e-07

Best Hits

Swiss-Prot: 80% identical to CPOB_PSEPK: Cell division coordinator CpoB (cpoB) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 92% identity to pba:PSEBR_c2g93)

Predicted SEED Role

"TPR repeat containing exported protein; Putative periplasmic protein contains a protein prenylyltransferase domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QKQ6 at UniProt or InterPro

Protein Sequence (252 amino acids)

>PfGW456L13_1860 TPR repeat containing exported protein; Putative periplasmic protein contains a protein prenylyltransferase domain (Pseudomonas fluorescens GW456-L13)
VVDNDSGYNNSGSSYPPAGYGTNGAYAGGGVSAPVSAQGELFNQLQSMQQQIERQQGAIE
VLQNDVARMKQENLERYQDLDRRIGTGVAPAATPENSSTGGDLNAPGAAAGAGAAAAQAP
AAGSEPADPAKEKLYYDAAFDLIKAKDFDKASQAFAAFLRKYPNSQYAGNAQYWLGEVNL
AKGDLQGAGQAFAKVSQLYPKHAKVPDSLYKLADVERRLGHTDRVKGILQQVVSQYPGTS
AAQLAQRDLQKM