Protein Info for PfGW456L13_1858 in Pseudomonas fluorescens GW456-L13

Annotation: tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 TIGR02800: Tol-Pal system beta propeller repeat protein TolB" amino acids 3 to 410 (408 residues), 521.1 bits, see alignment E=1.1e-160 PF04052: TolB_N" amino acids 6 to 108 (103 residues), 93.6 bits, see alignment E=1.6e-30 PF07676: PD40" amino acids 176 to 209 (34 residues), 28.8 bits, see alignment 1.8e-10 amino acids 218 to 253 (36 residues), 51.4 bits, see alignment 1.5e-17 amino acids 262 to 297 (36 residues), 54.7 bits, see alignment 1.4e-18 amino acids 354 to 381 (28 residues), 13.1 bits, see alignment (E = 1.5e-05)

Best Hits

Swiss-Prot: 96% identical to TOLB_PSEPF: Tol-Pal system protein TolB (tolB) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03641, TolB protein (inferred from 96% identity to pfo:Pfl01_4402)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0F4TFV0 at UniProt or InterPro

Protein Sequence (414 amino acids)

>PfGW456L13_1858 tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins (Pseudomonas fluorescens GW456-L13)
MADEKNILVTSGSDRATPIAVVPFGFQGGSVLPDDMAEIIGNDLRNSGYYSPLPKQNMIS
QPSQASEIIFRDFKALGAQYVMVGSIVPAGGRLQVQYALFNVATEQQVLTGSVSGGVDQL
RDMAHYISDQSFEKLTGIKGAFSTRLLYVTAERFSENNTRYTLQRSDYDGARAVTLLQSR
EPILSPRFAPDGKRIAYVSFEQKRPRIFMQNIDTGRREQITNFEGLNGAPAWSPDGNRLA
FVLSKDGNPDIYVMNLGSRQISRVTNGPGINTEPFWGKDGSTIYFTSDRGGKPQIYKTSA
GGGGAERVTFVGNYNANPKLSADEKTLVMIHRQDGFTNFKVAAQDLQRGSVKILTDSTLD
ESPTVAPNGTMVIYATRQQGRGVLMLVSINGRVRLPLPTAQGEVREPSWSPYLN