Protein Info for PfGW456L13_1798 in Pseudomonas fluorescens GW456-L13

Annotation: ABC spermidine/putrescine transporter, inner membrane subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 86 to 108 (23 residues), see Phobius details amino acids 119 to 142 (24 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details amino acids 196 to 218 (23 residues), see Phobius details amino acids 224 to 242 (19 residues), see Phobius details amino acids 253 to 271 (19 residues), see Phobius details PF00528: BPD_transp_1" amino acids 102 to 271 (170 residues), 61.1 bits, see alignment E=6.1e-21

Best Hits

KEGG orthology group: None (inferred from 97% identity to pfo:Pfl01_4467)

Predicted SEED Role

"ABC spermidine/putrescine transporter, inner membrane subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QI79 at UniProt or InterPro

Protein Sequence (282 amino acids)

>PfGW456L13_1798 ABC spermidine/putrescine transporter, inner membrane subunit (Pseudomonas fluorescens GW456-L13)
MSTLIKKRYGLLPGETGKFAGILSGFILLLAVLPILTMIVMSFSGASNLDFPPSSYSLQW
YKAAWHTFVSPDASDVLSLGQAMSTSLLVSCLTMIFATIIAVPAAYALTRCEFRGKAVAL
QLMSLPLVFPMVVLGLALLLVFDSLPFHMTTSRLVIAHVILALPFVVKNCTAAMLSIGSE
VEEAAQMLGASPLRAIVDVVVPLMKSGILAGMLLAFIVSFNEFTVTYFLYTIDVMTVPIW
MYSRTVSSLDPTVFSFAVLIVLIDFVLIWALEKLVGEGGVSF