Protein Info for PfGW456L13_1735 in Pseudomonas fluorescens GW456-L13

Annotation: Glycerol uptake facilitator protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 32 to 52 (21 residues), see Phobius details amino acids 63 to 85 (23 residues), see Phobius details amino acids 105 to 125 (21 residues), see Phobius details amino acids 163 to 183 (21 residues), see Phobius details amino acids 195 to 218 (24 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details PF00230: MIP" amino acids 19 to 268 (250 residues), 209.2 bits, see alignment E=3.7e-66 TIGR00861: MIP family channel proteins" amino acids 30 to 268 (239 residues), 231.9 bits, see alignment E=4e-73

Best Hits

Swiss-Prot: 82% identical to GLPF_PSEAE: Glycerol uptake facilitator protein (glpF) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02440, glycerol uptake facilitator protein (inferred from 94% identity to pfo:Pfl01_4531)

MetaCyc: 69% identical to glycerol facilitator (Escherichia coli K-12 substr. MG1655)
RXN0-7189; RXN0-7191; TRANS-RXN-131; TRANS-RXN0-460; TRANS-RXN0-536; TRANS-RXN0-537; TRANS-RXN0-551

Predicted SEED Role

"Glycerol uptake facilitator protein" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerol fermenation to 1,3-propanediol

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QKX5 at UniProt or InterPro

Protein Sequence (297 amino acids)

>PfGW456L13_1735 Glycerol uptake facilitator protein (Pseudomonas fluorescens GW456-L13)
MMEKAPDNKKNEVSMTTDLQQPSLSSQCMAEFLGTALLIFFGTGCVAALKVAGASFGLWE
ISIIWGVGVSMAIYLTAGVSGAHLNPAVSIALSIFADFEKRKLPFYIFAQVAGAFCGALL
VYTLYSNLFFEFEQTHHMVRGTQASLELASVFSTFPNPVLTTAQAFLVEVIITAILMGVI
MSLTDDNNGLPKGPLAPLLIGLLIAVIGSSMGPLTGFAMNPARDFGPKLMTFFAGWGEIS
FTGGRDIPYFLIPVFAPIVGACLGAAAYRGLIARHLPSAVPATKDATAAIDGKPRTS