Protein Info for PfGW456L13_1505 in Pseudomonas fluorescens GW456-L13

Annotation: FIG028593: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 42 to 58 (17 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details amino acids 105 to 129 (25 residues), see Phobius details amino acids 138 to 164 (27 residues), see Phobius details amino acids 182 to 206 (25 residues), see Phobius details PF01891: CbiM" amino acids 4 to 208 (205 residues), 63.5 bits, see alignment E=1.3e-21

Best Hits

KEGG orthology group: None (inferred from 89% identity to pfo:Pfl01_4826)

Predicted SEED Role

"FIG028593: membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QVB7 at UniProt or InterPro

Protein Sequence (229 amino acids)

>PfGW456L13_1505 FIG028593: membrane protein (Pseudomonas fluorescens GW456-L13)
MIGAELLSSQTLAVGWLIYVPVLIWAICRAPWVELFTDSRRQHLLFGTVFALFLLWLVRR
DFDTGVSYHFIGMTAVTLLLDWPLALVGGLVAQTGLVLLGRQDLAAVGVNGALLIALPVL
VTECCAILVERAQPRNPFVYIFVSGFFAAALSALLCLLLALWLLWFDERFAMPYWLEDFV
GYLWLIIFPEAFINGMIVSALVVFCPEWLETFNRTRYLSAPWKDDDPKS