Protein Info for PfGW456L13_1210 in Pseudomonas fluorescens GW456-L13

Annotation: Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 PF00005: ABC_tran" amino acids 31 to 173 (143 residues), 129.7 bits, see alignment E=1.3e-41 TIGR01187: polyamine ABC transporter, ATP-binding protein" amino acids 46 to 365 (320 residues), 388.1 bits, see alignment E=1.5e-120 PF08402: TOBE_2" amino acids 290 to 367 (78 residues), 65.3 bits, see alignment E=4.6e-22

Best Hits

Swiss-Prot: 48% identical to POTA_ROSDO: Spermidine/putrescine import ATP-binding protein PotA (potA) from Roseobacter denitrificans (strain ATCC 33942 / OCh 114)

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a5128)

Predicted SEED Role

"Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0F4TXQ5 at UniProt or InterPro

Protein Sequence (374 amino acids)

>PfGW456L13_1210 Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1) (Pseudomonas fluorescens GW456-L13)
MSQVDSSAGANDVLVSFRGVQKSYDGENLIVKDLNLDIRKGEFLTLLGPSGSGKTTSLMM
LAGFETPTAGEILLAGRAINNVPPHKRDIGMVFQNYALFPHMTVAENLAFPLTVRGMNKS
DVSARVKRVLSMVQLDAFAQRYPAQLSGGQQQRVALARALVFEPQLVLMDEPLGALDKQL
REHMQMEIKHLHQRLGVTVVYVTHDQGEALTMSDRVAVFHQGEIQQIAPPRTLYEEPKNT
FVANFIGENNRLNGRLHSQTGDRCIVELGRGEKVEALAVNVGQTGEPVTLSIRPERVSLN
GSSDQCVNRFSGRVEEFIYLGDHVRVRMEVCGKTDFFVKQPIAELDPSLAVGDVVPLGWQ
VEHVRALDPLLEAH