Protein Info for PfGW456L13_1010 in Pseudomonas fluorescens GW456-L13

Annotation: Pyrroline-5-carboxylate reductase (EC 1.5.1.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF03446: NAD_binding_2" amino acids 5 to 96 (92 residues), 25.3 bits, see alignment E=3.7e-09 PF03807: F420_oxidored" amino acids 5 to 99 (95 residues), 79.2 bits, see alignment E=7.4e-26 TIGR00112: pyrroline-5-carboxylate reductase" amino acids 6 to 266 (261 residues), 260.7 bits, see alignment E=8.5e-82 PF01210: NAD_Gly3P_dh_N" amino acids 45 to 105 (61 residues), 28.6 bits, see alignment E=3.3e-10 PF14748: P5CR_dimer" amino acids 162 to 266 (105 residues), 123.7 bits, see alignment E=9.2e-40

Best Hits

Swiss-Prot: 74% identical to P5CR_PSEAE: Pyrroline-5-carboxylate reductase (proC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00286, pyrroline-5-carboxylate reductase [EC: 1.5.1.2] (inferred from 91% identity to pba:PSEBR_a5322)

MetaCyc: 42% identical to pyrroline-5-carboxylate reductase (Hordeum vulgare)
Pyrroline-5-carboxylate reductase. [EC: 1.5.1.2]

Predicted SEED Role

"Pyrroline-5-carboxylate reductase (EC 1.5.1.2)" in subsystem Proline Synthesis (EC 1.5.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QIX3 at UniProt or InterPro

Protein Sequence (272 amino acids)

>PfGW456L13_1010 Pyrroline-5-carboxylate reductase (EC 1.5.1.2) (Pseudomonas fluorescens GW456-L13)
MSKTRIAFIGAGNMAASLIGGLRAKGLEAAQIRASDPGEETRARVSAEHGIETFADNAQA
IDGADVVVLAVKPQAMKAVCEAIRPSLKPHQLVVSIAAGITCASMNNWLGAQPIVRCMPN
TPALVRQGASGLFATTEVSAEQRQQAQELLSAVGIALWLNEEQQLDAVTAVSGSGPAYFF
LLIEAMTAAGVKLGLPADIAAQLTLQTALGAAHMAVSSDVDAAELRRRVTSPAGTTEAAI
KSFQANGFEALVEKALGAAAHRSAEMAEQLGQ