Protein Info for PP_5699 in Pseudomonas putida KT2440

Annotation: putative iron uptake protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 101 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 50 to 70 (21 residues), see Phobius details amino acids 77 to 98 (22 residues), see Phobius details PF12365: DUF3649" amino acids 68 to 89 (22 residues), 35.8 bits, see alignment 2.6e-13

Best Hits

KEGG orthology group: None (inferred from 96% identity to ppf:Pput_4470)

Predicted SEED Role

"FIG024006: iron uptake protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A140FWQ1 at UniProt or InterPro

Protein Sequence (101 amino acids)

>PP_5699 putative iron uptake protein (Pseudomonas putida KT2440)
MTRKTAGLPFSYRLGVASRSLAALLGGYLLASMASVCIALLAPLPKVDATLTGLLLSFVF
YLLAFIWCFACRSAWRAWLGVLAPSLLLGVISGVAYWMKNA