Protein Info for PP_5673 in Pseudomonas putida KT2440

Annotation: putative D-alanine--D-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 PF02655: ATP-grasp_3" amino acids 97 to 267 (171 residues), 28 bits, see alignment E=4.3e-10 PF07478: Dala_Dala_lig_C" amino acids 107 to 293 (187 residues), 127.3 bits, see alignment E=1.2e-40 PF13535: ATP-grasp_4" amino acids 134 to 268 (135 residues), 31.4 bits, see alignment E=2.9e-11

Best Hits

KEGG orthology group: K01921, D-alanine-D-alanine ligase [EC: 6.3.2.4] (inferred from 99% identity to ppf:Pput_1516)

Predicted SEED Role

"D-alanine--D-alanine ligase (EC 6.3.2.4)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.2.4

Use Curated BLAST to search for 6.3.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A140FWM5 at UniProt or InterPro

Protein Sequence (304 amino acids)

>PP_5673 putative D-alanine--D-alanine ligase (Pseudomonas putida KT2440)
MIENIAIITGGNSSEREVSLQTSEAVSQSLKTLQISHEILTISDYRELLSLDLAKFTRVF
LALHGGFGENGMAQAYLEGLGIPYNGPSPQASAICMDKLLTKHIARGLGINVANYLYSKN
GDDVCFEEISERLGTPCIVKPNREGCSFGVSLVRDLKADLQPAINAAAKFHTGILIEEFI
SGPELSVCYLNKSTLPIYTVEFESDFFSYDAKFISTKTNATLTILDRSTHQLVTNYCSAI
AEALELDYFRADFIVHNTEPYLIELNTLPGLTSHSLFPKACQQHGIEFDKLVLILNNLDP
SQYC