Protein Info for PP_5602 in Pseudomonas putida KT2440

Annotation: quinohaemoprotein amine dehydrogenase, alpha subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 542 signal peptide" amino acids 1 to 49 (49 residues), see Phobius details TIGR03908: quinohemoprotein amine dehydrogenase, alpha subunit" amino acids 46 to 541 (496 residues), 692.6 bits, see alignment E=1.5e-212 PF09098: Dehyd-heme_bind" amino acids 52 to 215 (164 residues), 242.1 bits, see alignment E=6.3e-76 PF14930: Qn_am_d_aII" amino acids 227 to 328 (102 residues), 127.4 bits, see alignment E=6.9e-41 PF09099: Qn_am_d_aIII" amino acids 331 to 411 (81 residues), 67.5 bits, see alignment E=2.6e-22 PF09100: Qn_am_d_aIV" amino acids 416 to 541 (126 residues), 156.3 bits, see alignment E=9.4e-50

Best Hits

KEGG orthology group: K08685, quinohemoprotein amine dehydrogenase [EC: 1.4.98.1] (inferred from 99% identity to ppf:Pput_2307)

MetaCyc: 95% identical to quinohaemoprotein amine dehydrogenase alpha subunit (Pseudomonas putida U)
1.4.98.-

Predicted SEED Role

"Quinohemoprotein amine dehydrogenase 60 kDa subunit"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.98.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A140FWF3 at UniProt or InterPro

Protein Sequence (542 amino acids)

>PP_5602 quinohaemoprotein amine dehydrogenase, alpha subunit (Pseudomonas putida KT2440)
MHTCCTKACENDKNNNRGGLTLKTTRLRRHAGKLALVAAALLSTQAMAAEQGPSLLQNKC
MGCHIPEGNDTYSRISHQRKTPEGWLMSIARMQVMHGLQISDDDRRTLVKYLADKQGLAP
SETDGVRYAMERRLNTVEHFDTQLSETCGRCHSGARVALQRRPAKEWEHLVHFHLGQWPS
LEYQAQARDRDWLPIALQQVVPDLAKRFPMDSAAWDEWQKAKPKADVLPGKWAFSGHMLA
KGDVRGVMSVTAGEGDTFKVEVKGAYADGTPFNGSGSAILYNGYEWRGNVKVGDANLRQV
FAALDGEMKGRMFEADHDERGLDFSAVKEGKAQLLAVQPAFIKAGGESEITLVGSGLTGK
PELGAGVEVTEVLEQTPTLVRVKARAASDARPGLREVAVGALKGVNLAVYDKVDEVKVVP
AFSIARIGENGASVPKVQGRFEAEAWGKDANGQPLRIGYLPASWKVEPFNERAVEDEDVK
FAGQMQADGVFVPGGAGPNPERKMMTNNAGNLKVIATLADGGQTGEGHMIVTVQRWNNPP
LP