Protein Info for PP_5490 in Pseudomonas putida KT2440

Annotation: site-specific DNA recombinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 PF00239: Resolvase" amino acids 3 to 135 (133 residues), 143.3 bits, see alignment E=9.1e-46 PF02796: HTH_7" amino acids 141 to 180 (40 residues), 24.7 bits, see alignment 3.1e-09

Best Hits

Swiss-Prot: 42% identical to BINR_STAAU: Transposon Tn552 DNA-invertase BinR (resR) from Staphylococcus aureus

KEGG orthology group: None (inferred from 67% identity to amv:ACMV_P4_00310)

MetaCyc: 43% identical to e14 prophage; site-specific DNA recombinase (Escherichia coli K-12 substr. MG1655)
5.99.1.-

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A140FW44 at UniProt or InterPro

Protein Sequence (188 amino acids)

>PP_5490 site-specific DNA recombinase (Pseudomonas putida KT2440)
MNIGYARVSTSGQDLELQRQLLTQSGCARIFEEKISGAKMERPELMRLLDHLRPGDVVVV
SRLDRLARSTIDLLSIAEQLNRLGAGLQSLSEPWLNTTTAAGQMIMTIFAGIASFERSLI
VDRTRAGREAAQRKGIKFGPKPRLSKEQIEHAEMLVVAGKSVAQIAGLLGVHRATLYRAL
KSAGSQLN