Protein Info for PP_5412 in Pseudomonas putida KT2440

Annotation: ATP synthase epsilon chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 TIGR01216: ATP synthase F1, epsilon subunit" amino acids 4 to 133 (130 residues), 145.5 bits, see alignment E=4.6e-47 PF02823: ATP-synt_DE_N" amino acids 6 to 83 (78 residues), 105.1 bits, see alignment E=1.5e-34 PF00401: ATP-synt_DE" amino acids 89 to 133 (45 residues), 32.9 bits, see alignment E=5.8e-12

Best Hits

Swiss-Prot: 100% identical to ATPE_PSEPK: ATP synthase epsilon chain (atpC) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K02114, F-type H+-transporting ATPase subunit epsilon [EC: 3.6.3.14] (inferred from 100% identity to ppu:PP_5412)

MetaCyc: 55% identical to ATP synthase F1 complex subunit epsilon (Escherichia coli K-12 substr. MG1655)
ATPSYN-RXN [EC: 7.1.2.2]; RXN0-7041 [EC: 7.1.2.2]

Predicted SEED Role

"ATP synthase epsilon chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14 or 7.1.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88BX5 at UniProt or InterPro

Protein Sequence (139 amino acids)

>PP_5412 ATP synthase epsilon chain (Pseudomonas putida KT2440)
MAMTVHCDIVSAEGEIFSGLVEMVVAHGNLGDLGIAPGHAPLITNLKPGPITLTKQGGAH
EVFYISGGFLEVQPNMVKVLADTVQRAADLDEAQAQEALKAAENALNLKGADFDYGAAAA
RLAEAAAQLRTVQQMRKGK