Protein Info for PP_5389 in Pseudomonas putida KT2440

Annotation: conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 41 to 65 (25 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 146 to 177 (32 residues), see Phobius details PF04140: ICMT" amino acids 103 to 187 (85 residues), 33.3 bits, see alignment E=5.2e-12 PF04191: PEMT" amino acids 127 to 193 (67 residues), 31.9 bits, see alignment E=1.5e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_0025)

Predicted SEED Role

"Bll7991 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88BZ4 at UniProt or InterPro

Protein Sequence (219 amino acids)

>PP_5389 conserved hypothetical protein (Pseudomonas putida KT2440)
MNHGESAYGLWSLVFINSAIFIMFAFSFFKPATARDWRSFGAFSAFIVALFVEMYGFPLT
IYLLSGWLQARFPNLDLLSHESGHLWSTLLGDQGNPHFSVLHIASYLFLGFGFYLLSAAW
NVLYHAQRRHSLATVGPYGWIRHPQYVAFVLILLGFLLQWPTLLTLAMFPVLLVMYGRLA
VSEEREMHKQFGAAYEAYTRVTPRFVPHLRERLGGGHRG