Protein Info for PP_5368 in Pseudomonas putida KT2440

Annotation: Major facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 57 (21 residues), see Phobius details amino acids 63 to 88 (26 residues), see Phobius details amino acids 94 to 119 (26 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 202 to 225 (24 residues), see Phobius details amino acids 235 to 253 (19 residues), see Phobius details amino acids 265 to 284 (20 residues), see Phobius details amino acids 290 to 311 (22 residues), see Phobius details amino acids 323 to 344 (22 residues), see Phobius details amino acids 354 to 372 (19 residues), see Phobius details PF07690: MFS_1" amino acids 205 to 371 (167 residues), 71.6 bits, see alignment E=3e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_5368)

Predicted SEED Role

"putative MFS transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88C15 at UniProt or InterPro

Protein Sequence (385 amino acids)

>PP_5368 Major facilitator family transporter (Pseudomonas putida KT2440)
MFALSKRFGTIYVAALLMQLGSSLLMTYLALRLNASGVAQVWGGALMAANALGMVVGARS
GYWLIGLVGHARAFVVSAGVIVTAVLSHQLSDGLLLWLALRFVVGAAMMGQLMVIESWLN
DCAPVSRRGGAMSLYMVASYVGMMLGQLMLSLGDGLHTLALTGVAMAFAIGLIPVALHNG
TQPSNINQARIKPMLYLRRLPQSLFTILASGLLNGCLYGLTPIFAAQLGFSPAQVGQFMA
VSIAAGLLAQLPLGKLSDHISRITLIRATAALLCIAYLPLAFGLASGQLWIMLAGAAIGF
LQFCLYPLGVAHANDNLEPELRVSLAGVLLMTFGIGATIGPLVAGAMMEHAGPQALYLFG
IGVTAMVVCFIRNKSGVDVSLARLS