Protein Info for PP_5335 in Pseudomonas putida KT2440

Annotation: N5-carboxyaminoimidazole ribonucleotide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 PF22660: RS_preATP-grasp-like" amino acids 1 to 95 (95 residues), 107.3 bits, see alignment E=6.7e-35 TIGR01161: phosphoribosylaminoimidazole carboxylase, ATPase subunit" amino acids 2 to 349 (348 residues), 358.1 bits, see alignment E=3.1e-111 PF02222: ATP-grasp" amino acids 104 to 277 (174 residues), 203.9 bits, see alignment E=2.4e-64 PF17769: PurK_C" amino acids 298 to 349 (52 residues), 45.7 bits, see alignment 6.6e-16

Best Hits

Swiss-Prot: 90% identical to PURK_PSEAE: N5-carboxyaminoimidazole ribonucleotide synthase (purK) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01589, 5-(carboxyamino)imidazole ribonucleotide synthase [EC: 6.3.4.18] (inferred from 100% identity to ppf:Pput_5243)

Predicted SEED Role

"Phosphoribosylaminoimidazole carboxylase ATPase subunit (EC 4.1.1.21)" in subsystem De Novo Purine Biosynthesis (EC 4.1.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.21

Use Curated BLAST to search for 4.1.1.21 or 6.3.4.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88C48 at UniProt or InterPro

Protein Sequence (360 amino acids)

>PP_5335 N5-carboxyaminoimidazole ribonucleotide synthase (Pseudomonas putida KT2440)
MKIGVIGGGQLGRMLALAGTPLGMNFAFLDPAPDACAAPLGEHLRADYGDQDHLRQLADE
VDLVTFEFESVPAETVAFLSQFVPVYPSAESLRIARDRLFEKSMFRDLGIPTPAFADILS
QADLDAAVASIGLPAVLKTRTLGYDGKGQKVLRTPEDVVGTFAELGSVPCLLEGFVPFTG
EVSLVAVRGRDGETRFYPLVHNTHESGILRLSVASQAHPLQALAEDYVGRVLQKLDYVGV
MAFEFFEVDGGLKANEIAPRVHNSGHWTIEGAECSQFENHLRAVAGLPLGSTAKVGESAM
LNFIGEVPAVDKVVAIGDCHLHHYGKAFKVGRKVGHATLRCPDMATLERKIAEVEALISN