Protein Info for PP_5322 in Pseudomonas putida KT2440

Annotation: putative metal ion transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 148 to 170 (23 residues), see Phobius details PF01595: CNNM" amino acids 20 to 207 (188 residues), 177.9 bits, see alignment E=2.5e-56 PF00571: CBS" amino acids 237 to 288 (52 residues), 32.1 bits, see alignment 1.8e-11 amino acids 303 to 353 (51 residues), 28.3 bits, see alignment 2.8e-10 PF03471: CorC_HlyC" amino acids 372 to 444 (73 residues), 59.8 bits, see alignment E=3.2e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_5230)

Predicted SEED Role

"Phosphate regulon metal ion transporter containing CBS domains"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88C61 at UniProt or InterPro

Protein Sequence (446 amino acids)

>PP_5322 putative metal ion transporter (Pseudomonas putida KT2440)
MDPSSGISLTSLFADFGMIIFAFLLVLLNGFFVAAEFAMVKLRATRVEAIAEKHGWRGNI
LRKVHNQLDAYLSACQLGITLASLGLGWVGEPAFAHLLEPLLAYLGVDSAELVKAISFFV
AFFVISYLHIVVGELAPKSWAIRKPELLSLWTAVPLYLFYWAMYPAIYLLNASANTILRI
AGQGEPGPHHEHHYSREELKLILHSSRGQDPSDQGMRVLASAVEMGELEVVDWANSREDM
ISIDAHAPLKQILALVRRHKFSRYPVYDAEREEFTGLLHIKDLLLELAELEHLPETIDLE
DLARPLERVSRHMPLAQLLEQFRKGGAHFVLVEEADGKVIGYLTMEDVLEVLVGDIQDEH
RKTERGILAYQPGKLLVRGDTPLFKVERLLGIDLDHIEAETLAGLIYETLKRVPEEEEVL
EVEGLRIIIKKMKGPKIVLAKVLKLD